PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00135.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 314aa    MW: 35235.1 Da    PI: 5.4143
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00135.1_g00028.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.5e-51141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+v+yL++k++g +++l + i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkat
  Rsa1.0_00135.1_g00028.1  14 LPPGFRFYPTDEELMVQYLCRKAAGYDFSL-QLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKAT 98 
                              79***************************9.89***************8888899******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk + + +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Rsa1.0_00135.1_g00028.1  99 GTDKIIST-EGKRVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                              **999988.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-669162IPR003441NAC domain
PROSITE profilePS5100559.63914162IPR003441NAC domain
PfamPF023651.4E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGIEETDPLA QLSLPPGFRF YPTDEELMVQ YLCRKAAGYD FSLQLIAEID LYKFDPWVLP  60
NKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGKR VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLL EPSHRDGSSK LDDWVLCRIY KKQSSAQKQA YENVITSTRE  180
LSNNGTSSTT SSSSHFEDVL DSLHHETDNR NFQYANPNQF SSLRPDLTGD KTGINGLSDT  240
SSFDWGSFVG NVEHNSGPEP GLSHVVPSIE FNSGYLKMEE EFNNPDDFGF AQNGYGIDSV  300
GFGYPGQVGG FGFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-12011687174NAC domain-containing protein 19
3swm_B1e-12011687174NAC domain-containing protein 19
3swm_C1e-12011687174NAC domain-containing protein 19
3swm_D1e-12011687174NAC domain-containing protein 19
3swp_A1e-12011687174NAC domain-containing protein 19
3swp_B1e-12011687174NAC domain-containing protein 19
3swp_C1e-12011687174NAC domain-containing protein 19
3swp_D1e-12011687174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00012PBMTransfer from AT1G52890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667470.0KC966747.1 Brassica napus NAC transcription factor 19 (NAC19.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009147649.10.0PREDICTED: NAC domain-containing protein 19
SwissprotQ9C9320.0NAC19_ARATH; NAC domain-containing protein 19
TrEMBLA0A0A7BWH70.0A0A0A7BWH7_BRANA; NAC transcription factor 19
STRINGBra018998.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.10.0NAC domain containing protein 19